PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g040510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 640aa    MW: 72412.2 Da    PI: 5.183
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g040510.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3348.31.6e-106472401200
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                       eel++rmw+d+mll+rlke++k+    ke+  + +k+++s+eqarrkkmsraQDgiLkYMlk+mevcnaqGfvYgiipekgkpv+gasd+Lra
  Sopen01g040510.1  47 EELERRMWRDRMLLRRLKEKNKN----KEV-GDGAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCNAQGFVYGIIPEKGKPVTGASDNLRA 134
                       8********************98....777.788899******************************************************** PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
              EIN3  94 WWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                       WWkekv+fdrngpaai+kyqa+n i+++ +++++   s++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+Gke+wwg+lgl
  Sopen01g040510.1 135 WWKEKVRFDRNGPAAIAKYQADNQIPGRVEESSV-IVSTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPSGKEDWWGQLGL 226
                       ****************************999988.********************************************************** PP

                       -TT--.-----GGG CS
              EIN3 187 skdqgtppykkphd 200
                       ++dq +ppykkphd
  Sopen01g040510.1 227 PNDQVQPPYKKPHD 240
                       *************9 PP

2EIN3220.98.4e-68242461163354
                       -TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT CS
              EIN3 163 plekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeek 255
                       plekgv+pPWWP+Gke+wwg+lgl++dq +ppykkphdlkkawkv+vLtavikh+sp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+
  Sopen01g040510.1 242 PLEKGVSPPWWPSGKEEWWGQLGLPNDQVQPPYKKPHDLKKAWKVGVLTAVIKHISPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEA 334
                       9******************************************************************************************** PP

                       -S--XXXXXX...XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX.............................XXXXXXXXXXXXXX CS
              EIN3 256 ecatvsahss...slrkqspkvtlsceqkedvegkkeskikhvqavktta.............................gfpvvrkrkkkpse 316
                       ++++++++s    sl  ++ ++++s+ +++dveg ++++ ++v++ k ++                             + ++++krk +p  
  Sopen01g040510.1 335 LARKLYPDSYpqgSLAVGNGSFFISDASDYDVEGVDNERNNEVEC-KPHDinlqtgimlpkdrvlmpglapvkgeiidlTSDFIQKRK-QPCF 425
                       ********444579999****************666666455555.444558***********************************9.7888 PP

                       XXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
              EIN3 317 sakvsskevsrtcqssqfrgsetelifadknsisqney 354
                       +++v +k  ++tc+  ++++s+++++f d++s++++++
  Sopen01g040510.1 426 EESVDQK--IYTCEYLHCPYSNYQAGFLDRTSRNNHQM 461
                       8899888..7**************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048737.8E-10147240No hitNo description
Gene3DG3DSA:1.10.3180.101.0E-36168240IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.09E-30173240IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.15E-43241336IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PfamPF048731.6E-42242333No hitNo description
Gene3DG3DSA:1.10.3180.102.1E-52242342IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MGIFEDMGFC GNFEFLSDSM GCGAQEVEHK PVGLEEDDYS DEEMDVEELE RRMWRDRMLL  60
RRLKEKNKNK EVGDGAKQRQ SQEQARRKKM SRAQDGILKY MLKMMEVCNA QGFVYGIIPE  120
KGKPVTGASD NLRAWWKEKV RFDRNGPAAI AKYQADNQIP GRVEESSVIV STPHTLQELQ  180
DTTLGSLLSA LMQHCDPPQR RFPLEKGVSP PWWPSGKEDW WGQLGLPNDQ VQPPYKKPHD  240
XPLEKGVSPP WWPSGKEEWW GQLGLPNDQV QPPYKKPHDL KKAWKVGVLT AVIKHISPDI  300
AKIRKLVRQS KCLQDKMTAK ESATWLAIIN QEEALARKLY PDSYPQGSLA VGNGSFFISD  360
ASDYDVEGVD NERNNEVECK PHDINLQTGI MLPKDRVLMP GLAPVKGEII DLTSDFIQKR  420
KQPCFEESVD QKIYTCEYLH CPYSNYQAGF LDRTSRNNHQ MSCPFRFNSA QTLTTPKYQI  480
NYEHNTVFPA QTATSKPAVS SVTASSSMSA SGLGLPEDDQ RIISDLITSY DNNFQQNGSI  540
CSGISEILIN QTLPQQQTVE LSMDGNFNLG HMETSAQETS VPAYRSTEFQ YDQCKMSFDA  600
PFGGNINDIT DYRFGSPFNL GGSDYAVEQL TKQDISTWYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-731713431134Protein ETHYLENE INSENSITIVE 3
4zds_B3e-731713431134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015062250.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLQ94FV20.0Q94FV2_SOLLC; EIL3
STRINGSolyc01g096810.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-176EIL family protein